General Information

  • ID:  hor002124
  • Uniprot ID:  P22969
  • Protein name:  Relaxin A chain
  • Gene name:  RLN
  • Organism:  Equus caballus (Horse)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLSHKCCYWGCTRKELARQC
  • Length:  20
  • Propeptide:  MRRLFLSHVLGAWLLLSQLPRELSGQKPDDVIKACGRELARLRIEICGSLSWKKTVLRLEEPGLEAGQPVEIVSSSISKDAEALNTKLGLNSNLPKEQKATLSERQPSWRELLQQPALKDSNLNLEEFEETILKTQSEVEDDSLSELKNLGLDKHSRKKRMIQLSHKCCYWGCTRKELARQC
  • Signal peptide:  MRRLFLSHVLGAWLLLSQLPRELSG
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-11
  • Structure ID:  AF-P22969-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002124_AF2.pdbhor002124_ESM.pdb

Physical Information

Mass: 275293 Formula: C101H161N33O28S4
Absent amino acids: DFIMNPV Common amino acids: C
pI: 8.68 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 4
Hydrophobicity: -76 Boman Index: -4956
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 44
Instability Index: 3313 Extinction Coefficient cystines: 7240
Absorbance 280nm: 381.05

Literature

  • PubMed ID:  2055195
  • Title:  Affinity purification and sequence determination of equine relaxin.